Hebp2 Antibody - N-terminal region : FITC

Hebp2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55019_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of RAT Hebp2

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: EMPSWKAPENIDPQPGSYEIRHYGPAKWVSTCVESLDWDSAIQTGFTKLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heme-binding protein 2

Protein Size: 203

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55019_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55019_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 308632
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×