HEMGN Antibody - N-terminal region : Biotin

HEMGN Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57794_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEMGN

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hemogen

Protein Size: 484

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57794_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57794_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55363
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×