HEPACAM Antibody - N-terminal region : FITC

HEPACAM Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55503_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LOW QUALITY PROTEIN: hepatocyte cell adhesion molecule; hepatocyte cell adhesion molecule

Protein Size: 307

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55503_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55503_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 300517
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×