HEPACAM Antibody - N-terminal region : HRP

HEPACAM Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55503_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LOW QUALITY PROTEIN: hepatocyte cell adhesion molecule; hepatocyte cell adhesion molecule

Protein Size: 307

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55503_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55503_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 300517
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×