HEXD Antibody - middle region : HRP

HEXD Antibody - middle region : HRP
Artikelnummer
AVIARP55666_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HEXDC

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: hexosaminidase D

Protein Size: 585

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55666_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55666_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284004
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×