HINT1 Antibody - N-terminal region : Biotin

HINT1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54767_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1

Key Reference: Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histidine triad nucleotide-binding protein 1

Protein Size: 126

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54767_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54767_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 3094
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×