HIRIP3 Antibody - middle region : Biotin

HIRIP3 Antibody - middle region : Biotin
Artikelnummer
AVIARP58286_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIRIP3

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HIRA-interacting protein 3

Protein Size: 556

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58286_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58286_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8479
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×