HIST2H2BF Antibody - N-terminal region : Biotin

HIST2H2BF Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56220_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF

Key Reference: Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone H2B type 2-F

Protein Size: 126

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56220_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56220_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 440689
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×