HJV Antibody - N-terminal region : FITC

HJV Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53489_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Two uORFs in the 5' UTR negatively regulate the expression and activity of the encoded protein. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HFE2

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: hemojuvelin

Protein Size: 200

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53489_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53489_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 148738
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×