HLX Antibody - middle region : FITC

HLX Antibody - middle region : FITC
Artikelnummer
AVIARP58016_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HLX is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLX

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: H2.0-like homeobox protein

Protein Size: 488

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58016_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58016_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3142
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×