HMCES Antibody - N-terminal region : Biotin

HMCES Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57365_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES

Key Reference: N/A

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0361 protein C3orf37

Protein Size: 354

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57365_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57365_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56941
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×