Hmgcl Antibody - C-terminal region : Biotin

Hmgcl Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56278_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hmgcl

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxymethylglutaryl-CoA lyase, mitochondrial

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56278_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56278_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79238
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×