HNF1A Antibody - N-terminal region : HRP

HNF1A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57904_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Key Reference: Eide,S.A., (er) Diabet. Med. (2008) In press

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatocyte nuclear factor 1-alpha

Protein Size: 631

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57904_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57904_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6927
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×