HOOK2 Antibody - middle region : HRP

HOOK2 Antibody - middle region : HRP
Artikelnummer
AVIARP54934_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Hook homolog 2

Protein Size: 719

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54934_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54934_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29911
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×