HOXD1 Antibody - middle region : HRP

HOXD1 Antibody - middle region : HRP
Artikelnummer
AVIARP57870_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD1

Key Reference: Kosaki,K., (2002) Teratology 65 (2), 50-62

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-D1

Protein Size: 328

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57870_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57870_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3231
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×