HP1BP3 Antibody - middle region : Biotin

HP1BP3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56875_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HP1BP3

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heterochromatin protein 1-binding protein 3

Protein Size: 553

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56875_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56875_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50809
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×