HP1BP3 Antibody - middle region : HRP

HP1BP3 Antibody - middle region : HRP
Artikelnummer
AVIARP56875_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HP1BP3

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Heterochromatin protein 1-binding protein 3

Protein Size: 553

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56875_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56875_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50809
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×