HSD17B14 Antibody - middle region : FITC

HSD17B14 Antibody - middle region : FITC
Artikelnummer
AVIARP56865_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSD17B14

Key Reference: Lukacik,P., (2007) Biochem. J. 402 (3), 419-427

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 17-beta-hydroxysteroid dehydrogenase 14

Protein Size: 270

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56865_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56865_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51171
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×