HSPA1L Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: HSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L

Key Reference: Buraczynska,M., (er) Clin. Sci. (2008) In press

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock 70 kDa protein 1-like

Protein Size: 641

Purification: Affinity Purified

• Artikelnummer: AVIARP53636_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53636_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3305
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin