HSPA2 Antibody - middle region : FITC

HSPA2 Antibody - middle region : FITC
Artikelnummer
AVIARP55382_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPA2 belongs to the heat shock protein 70 family.In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA2

Key Reference: Lee,S.H., (er) Dig. Dis. Sci. (2007) In press

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock-related 70 kDa protein 2

Protein Size: 639

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55382_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55382_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3306
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×