HSPA4L Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock 70 kDa protein 4L

Protein Size: 839

Purification: Affinity Purified

• Artikelnummer: AVIARP53693_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53693_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22824
• Wirt: Rabbit
• Konjugat: Conjugated, FITC