HSPA6 Antibody - middle region : HRP

HSPA6 Antibody - middle region : HRP
Artikelnummer
AVIARP54649_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA6

Key Reference: Noonan,E.J., (2007) Cell Stress Chaperones 12 (4), 393-402

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Heat shock 70 kDa protein 6

Protein Size: 643

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54649_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54649_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3310
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×