HSPB8 Antibody - middle region : FITC

HSPB8 Antibody - middle region : FITC
Artikelnummer
AVIARP55036_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPB8

Molecular Weight: 21

Peptide Sequence: Synthetic peptide located within the following region: PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock protein beta-8

Protein Size: 196

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55036_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55036_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26353
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×