Hspbp1 Antibody - C-terminal region : FITC

Hspbp1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54870_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hspbp1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54870_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54870_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 246146
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×