Hspbp1 Antibody - C-terminal region : HRP

Hspbp1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54869_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54869_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54869_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 246146
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×