HSPE1 Antibody - middle region : FITC

HSPE1 Antibody - middle region : FITC
Artikelnummer
AVIARP54651_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPE1

Key Reference: Ralph,S., (2007) Cancer Sci. 98 (6), 844-849

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 10 kDa heat shock protein, mitochondrial

Protein Size: 102

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54651_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54651_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3336
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×