HTRA4 Antibody - middle region : FITC

HTRA4 Antibody - middle region : FITC
Artikelnummer
AVIARP55603_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTRA4

Key Reference: Clausen,T., (2002) Mol. Cell 10 (3), 443-455

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine protease HTRA4

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55603_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55603_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 203100
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×