HYLS1 Antibody - middle region : HRP

HYLS1 Antibody - middle region : HRP
Artikelnummer
AVIARP55449_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HYLS1

Key Reference: Mee,L., (2005) Hum. Mol. Genet. 14 (11), 1475-1488

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hydrolethalus syndrome protein 1

Protein Size: 299

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55449_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55449_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219844
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×