IAH1 Antibody - N-terminal region : Biotin

IAH1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54504_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IAH1 is probable a lipase.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IAH1

Key Reference: N/A

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoamyl acetate-hydrolyzing esterase 1 homolog

Protein Size: 248

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54504_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54504_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285148
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×