IARS Antibody - N-terminal region : FITC

IARS Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54953_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IARS

Molecular Weight: 144kDa

Peptide Sequence: Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoleucine--tRNA ligase, cytoplasmic

Protein Size: 1262

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54953_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54953_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3376
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×