IDI1 Antibody - middle region : FITC

IDI1 Antibody - middle region : FITC
Artikelnummer
AVIARP54735_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-492 BE891119.1 50-541 493-1758 BX648472.1 1201-2466 1759-2150 BX537663.1 4550-4941

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IDI1

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isopentenyl-diphosphate Delta-isomerase 1

Protein Size: 284

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54735_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54735_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3422
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×