IER5 Antibody - N-terminal region : HRP

IER5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56939_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IER5

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immediate early response gene 5 protein

Protein Size: 327

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56939_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56939_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51278
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×