IFIT5 Antibody - middle region : Biotin

IFIT5 Antibody - middle region : Biotin
Artikelnummer
AVIARP54898_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFIT5

Key Reference: Niikura,T., (1997) Blood Cells Mol. Dis. 23 (3), 337-349

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced protein with tetratricopeptide repeats 5

Protein Size: 482

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54898_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54898_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24138
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×