IFIT5 Antibody - N-terminal region : Biotin

IFIT5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54897_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT5

Key Reference: Niikura,T., (1997) Blood Cells Mol. Dis. 23 (3), 337-349

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced protein with tetratricopeptide repeats 5

Protein Size: 482

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54897_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54897_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24138
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×