IFNA5 Antibody - middle region : Biotin

IFNA5 Antibody - middle region : Biotin
Artikelnummer
AVIARP54652_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFNA5

Key Reference: Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-5

Protein Size: 189

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54652_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54652_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3442
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×