IFNA8 Antibody - C-terminal region : FITC

IFNA8 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54654_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFNA8 is produced by macrophages, IFN-alpha have antiviral activities. It is a interferon which stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA8

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon alpha-8

Protein Size: 189

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54654_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54654_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3445
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×