IFRD1 Antibody - middle region : FITC

IFRD1 Antibody - middle region : FITC
Artikelnummer
AVIARP54585_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFRD1

Key Reference: Batta,K. (2007) Mol. Cell. Biol. 27 (21), 7603-7614

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-related developmental regulator 1

Protein Size: 451

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54585_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54585_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3475
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×