Ift80 Antibody - C-terminal region : FITC

Ift80 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57456_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ift80 is a component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intraflagellar transport protein 80 homolog

Protein Size: 777

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57456_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57456_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 68259
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×