Ift88 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 89kDa

Peptide Sequence: Synthetic peptide located within the following region: MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intraflagellar transport 88 homolog (Chlamydomonas) (Predicted) EMBL EDM14349.1

Protein Size: 815

Purification: Affinity Purified

• Artikelnummer: AVIARP53657_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53657_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 305918
• Wirt: Rabbit
• Konjugat: Conjugated, FITC