IGF2 Antibody - C-terminal region : HRP

IGF2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54342_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Insulin-like growth factor II Ala-25 Del Ensembl ENSP00000391826

Protein Size: 236

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54342_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54342_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3481
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×