IGFBP2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2

Key Reference: Hertel,J.K., (2008) Diabetologia 51 (6), 971-977

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor-binding protein 2

Protein Size: 328

Purification: Affinity Purified

• Artikelnummer: AVIARP54334_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54334_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3485
• Wirt: Rabbit
• Konjugat: Conjugated, FITC