Igfbp5 Antibody - middle region : Biotin

Igfbp5 Antibody - middle region : Biotin
Artikelnummer
AVIARP54337_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor binding protein 5, isoform CRA_a EMBL EDL00294.1

Protein Size: 271

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54337_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54337_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 16011
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×