Igfbp5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor binding protein 5, isoform CRA_a EMBL EDL00294.1

Protein Size: 271

Purification: Affinity Purified

• Artikelnummer: AVIARP54337_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54337_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 16011
• Wirt: Rabbit
• Konjugat: Conjugated, FITC