IL13RA2 Antibody - middle region : FITC

IL13RA2 Antibody - middle region : FITC
Artikelnummer
AVIARP53558_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2

Key Reference: Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-13 receptor subunit alpha-2

Protein Size: 380

Purification: Affinity Purified

Subunit: alpha-2
Mehr Informationen
Artikelnummer AVIARP53558_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53558_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3598
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×