IL13RA2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL13RA2

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interleukin-13 receptor subunit alpha-2

Protein Size: 380

Purification: Affinity Purified

Subunit: alpha-2

• Artikelnummer: AVIARP53557_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53557_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3598
• Wirt: Rabbit
• Konjugat: Conjugated, HRP