IL17D Antibody - N-terminal region : HRP

IL17D Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57724_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL17D

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Interleukin-17D

Protein Size: 202

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57724_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57724_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 53342
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×