IL1A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A

Key Reference: N/A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-1 alpha

Protein Size: 271

Purification: Affinity purified

• Artikelnummer: AVIARP54321_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54321_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Goat (Caprine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3552
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin