IL1F5 Antibody - middle region : FITC

IL1F5 Antibody - middle region : FITC
Artikelnummer
AVIARP55628_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL1F5

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-36 receptor antagonist protein

Protein Size: 155

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55628_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55628_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26525
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×