IL4 Antibody - middle region : Biotin

IL4 Antibody - middle region : Biotin
Artikelnummer
AVIARP54330_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: IL4 participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL4

Key Reference: Pachkoria,K., (2008) J. Hepatol. 49 (1), 107-114

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-4

Protein Size: 153

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54330_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54330_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3565
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×