IL6 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL6

Molecular Weight: 23 kDa

Peptide Sequence: Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: interleukin-6

Protein Size: 212

Purification: Affinity purified

• Artikelnummer: AVIARP54339_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54339_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Human Gene ID: 3569
• Wirt: Rabbit
• Konjugat: Conjugated, FITC